{ "event" : "markAsSpamWithoutRedirect", ] } }, }, "actions" : [ man kann in den USA beide zusammen betreiben oder eine deaktiveren ( das haben wir mit unser vodafone esim gemacht). Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" "event" : "expandMessage", "context" : "envParam:feedbackData", So einfach geht's: Meld Dich mit Deinen Kundendaten an und such Dir Deine Vodafone OneNumber als eSIM aus. { Das lässt keine weiteren Fragen offen. ] LITHIUM.CustomEvent('.lia-custom-event', 'click'); $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); { "context" : "envParam:quiltName", ] "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", Du bekommst von uns einen Aktivierungscode und eine ePIN (Bestätigungscode). { } //$('#vodafone-community-header').css('display','block'); expireDate.setDate(expireDate.getDate() + 365*10); Lies in dieser Schritt-für-Schritt Anleitung, wie Du Dein eSIM-Profil auf Deinem Android-Smartphone aktivierst. })(LITHIUM.jQuery); // Pull in global jQuery reference "event" : "expandMessage", "context" : "", Samsung und Apple, wird die ePIN auch Bestätigungscode genannt. "context" : "envParam:quiltName,message", LITHIUM.Loader.runJsAttached(); "actions" : [ if ( !watching ) { "initiatorBinding" : true, { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { ] { "actions" : [ "context" : "", }, "action" : "rerender" })(LITHIUM.jQuery); element.addClass('active'); "event" : "expandMessage", { "useSimpleView" : "false", { "actions" : [ }, "event" : "kudoEntity", .attr('aria-expanded','true') }, ;(function($) { "actions" : [ "displaySubject" : "true", ] "initiatorDataMatcher" : "data-lia-kudos-id" ] { "context" : "", "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" } }); "action" : "rerender" { "actions" : [ "includeRepliesModerationState" : "false", }, Bist du sicher, dass du fortfahren möchtest? ] Bei einer Vertragsverlängerung ist die erste eSIM kostenlos. { "context" : "", }, "context" : "", ] "context" : "lia-deleted-state", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); }, } "action" : "rerender" ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/239367","ajaxErrorEventName":"LITHIUM:ajaxError","token":"IIHckwtYlIZ_ppi1sxe_S0ctfAeVdO-cyq9hh8tpO-Y. "entity" : "2225865", { LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] { "actions" : [ "action" : "pulsate" { { "initiatorDataMatcher" : "data-lia-kudos-id" "useSimpleView" : "false", { { "event" : "MessagesWidgetCommentForm", $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); }, } "truncateBodyRetainsHtml" : "false", "action" : "rerender" } "context" : "envParam:quiltName", LITHIUM.AjaxSupport.ComponentEvents.set({ { "displayStyle" : "horizontal", { '; "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }); })(LITHIUM.jQuery); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", 5G approved device required, with an eligible Vodafone postpaid or prepaid mobile plan with 5G access, in a Vodafone 5G … ] "actions" : [ { { })(LITHIUM.jQuery); } Callya Digital – kostenlose Sim von Vodafone mit 10GB Volumen und Allnet Flat – Vodafone hat die eigenen Callya Freikarten schon immer mit sehr interessanten Neuerungen ausgestattet (beispielsweise als einer der ersten Anbieter mit schnellem LTE) und mit Callya Digital setzt das Unternehmen diesen Weg fort. { } "initiatorDataMatcher" : "data-lia-message-uid" "showCountOnly" : "false", "action" : "rerender" "event" : "MessagesWidgetAnswerForm", ] "selector" : "#kudosButtonV2_2", }, "}); "event" : "ProductAnswer", LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); // We're good so far. "selector" : "#kudosButtonV2_2", "quiltName" : "ForumMessage", //if(height > 430) { "action" : "rerender" "action" : "rerender" "actions" : [ var watching = false; }, "action" : "rerender" "useSimpleView" : "false", Lösung in ursprünglichem Beitrag anzeigen, Dem ist nichts weiter hinzuzufügen, perfekte Erklärung ttwa2011, Somit Thread gelöst  Haken dran und Schloss vor.Gruß,Matthias(Moderator), Bewertet hilfreiche Beiträge mit Likes und Sternen!Unaufgeforderte PNs werden nicht beantwortet - Bitte erstellt einen Thread. "eventActions" : [ "kudosable" : "true", { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); { "actions" : [ ;(function($) { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); { { "includeRepliesModerationState" : "false", } { "event" : "removeThreadUserEmailSubscription", "selector" : "#kudosButtonV2_1", Verwalte Deine Verträge, Kundendaten und Geräteeinstellungen für MeinVodafone. "action" : "rerender" watching = false; { }, "useSimpleView" : "false", }, "event" : "kudoEntity", "showCountOnly" : "false", } ] "context" : "", "action" : "pulsate" "quiltName" : "ForumMessage", }, "context" : "lia-deleted-state", "disableLinks" : "false", var count = 0; }, "action" : "rerender" ] .attr('aria-hidden','true') { { { "context" : "envParam:feedbackData", "action" : "rerender" "actions" : [ LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_2061f642b8b504_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/2001/thread-id/239367&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "envParam:quiltName,message", "action" : "rerender" $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() ] { { }, "triggerEvent" : "click", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ }); "actions" : [ Du brauchst also keine SIM-Karte mehr in Dein Gerät einzulegen. Dann stell sie uns einfach. }); { "closeEvent" : "LITHIUM:lightboxCloseEvent", { ', 'ajax'); Dein eSIM-Profil wird jetzt aktiviert. "showCountOnly" : "false", "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "ProductAnswer", { "action" : "rerender" { ], ;(function($) { ctaHTML += "Lösung noch nicht gefunden? } "actions" : [ "}); "useSubjectIcons" : "true", LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. $(document).keydown(function(e) { "event" : "addMessageUserEmailSubscription", if (element.hasClass('active')) { LITHIUM.AjaxSupport.ComponentEvents.set({ $('#node-menu li.has-sub>a').on('click', function(){ { { LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "removeMessageUserEmailSubscription", if(1 < 1){ { } "defaultAriaLabel" : "", "action" : "rerender" { }, }, }, "linkDisabled" : "false" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "", "event" : "RevokeSolutionAction", { "action" : "rerender" $('.lia-button-wrapper-searchForm-action').removeClass('active'); .attr('aria-expanded','false') Details zur Vodafone eSIM; Zu den Red Plus MultiSIM Infos; Telefónica: eSIM kostenlos mit o2 Free Connect – und zwar dauerhaft! { { ] }, //$('#community-menu-toggle').removeClass('active') "actions" : [ "truncateBodyRetainsHtml" : "false", "truncateBody" : "true", "componentId" : "forums.widget.message-view", ] { "displayStyle" : "horizontal", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); Especially when you bought a used iPhone to save a few dollars, and it turns out that its … ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "ProductAnswer", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2225865 .lia-rating-control-passive', '#form_1'); "context" : "envParam:quiltName", }, "actions" : [ "action" : "rerender" }, lithadmin: [] "disableLabelLinks" : "false", { }, LITHIUM.Loader.runJsAttached(); "componentId" : "kudos.widget.button", "truncateBody" : "true", }, "disableLabelLinks" : "false", ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }); ] var count = 0; } Du wohnst in NRW, BW oder Hessen? }, // Oops. "actions" : [ "event" : "ProductAnswerComment", // If watching, pay attention to key presses, looking for right sequence. { "event" : "editProductMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); "context" : "", "event" : "addThreadUserEmailSubscription", { } ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); Please ensure you have your eSIM compatible device with you so … } "actions" : [ } "action" : "rerender" "disableKudosForAnonUser" : "false", }, } Bei Onlineabschluss ist direkt keine esim auswählbar. } { LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234545}); }, "actions" : [ } }, watching = false; "useSubjectIcons" : "true", "revokeMode" : "true", "action" : "rerender" "kudosable" : "true", "initiatorBinding" : true, }, { { "action" : "rerender" "action" : "rerender" "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'ofkxD_AdTfOkn7iyoftG85NVCF0IK1zlA08WrYDR_xE. ] Außerdem bietet mit mobilcom-debitel ein Provider eSIM mit iOS 12.1 Update für iPhone XS, iPhone XS Max und iPhone XR. "action" : "rerender" It packed with lots of features and advanced functions. { } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2228045,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. if ( watching ) { }); }, "parameters" : { }, "context" : "envParam:quiltName,product,contextId,contextUrl", Vielen Dank! { "event" : "ProductAnswer", "revokeMode" : "true", { "event" : "RevokeSolutionAction", { "componentId" : "kudos.widget.button", } Betreff: eSIM statt physische SIM-Karte - kostenlos oder nicht? { } { { "action" : "rerender" "action" : "pulsate" count = 0; "context" : "", Dafür brauchst Du Deinen Aktivierungscode und den zugehörigen Bestätigungscode, also Deine ePIN. "context" : "lia-deleted-state", "actions" : [ var resetMenu = function() { "action" : "rerender" "event" : "MessagesWidgetMessageEdit", { ;(function($) { { }, "initiatorBinding" : true, { { "disableLabelLinks" : "false", "componentId" : "kudos.widget.button", "actions" : [ window.onclick = function(event) { "action" : "rerender" "context" : "envParam:quiltName", "disableLinks" : "false", $(document).keydown(function(e) { $(document).ready(function(){ { "action" : "rerender" { "event" : "editProductMessage", { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2228045,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, ] "context" : "", ] { "displayStyle" : "horizontal", Mehr dazu findest Du bei unseren Smartwatch-Angeboten. Bei einer Vertragsverlängerung ist die erste eSIM kostenlos. { { "event" : "MessagesWidgetMessageEdit", "displayStyle" : "horizontal", müssen. { ] "useSubjectIcons" : "true", "context" : "envParam:quiltName", } "eventActions" : [ "action" : "rerender" { { { { }, } } "actions" : [ LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; Vertrag dazu buchen. "event" : "AcceptSolutionAction", "event" : "markAsSpamWithoutRedirect", "context" : "", LITHIUM.Loader.runJsAttached(); { "event" : "MessagesWidgetEditAnswerForm", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); Danke! { "showCountOnly" : "false", Buy online or call 08080 408 408. "action" : "rerender" "event" : "expandMessage", "useSimpleView" : "false", "useSimpleView" : "false", { LITHIUM.Dialog({ Hättest Du uns deswegen telefonisch oder schriftlich kontaktiert? ', 'ajax'); "revokeMode" : "true", "initiatorDataMatcher" : "data-lia-message-uid" Wichtig: Prüfe, ob der Tarif auf Deinem eSIM-Profil mit dem neuen Gerät genutzt werden kann. "disableLabelLinks" : "false", "actions" : [ if ( watching ) { "event" : "addThreadUserEmailSubscription", { "action" : "rerender" ] { { { Dein Kommentar hilft uns. "parameters" : { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "action" : "rerender" { "parameters" : { "selector" : "#messageview_1", "event" : "ProductAnswer", Warum konnten wir Dir nicht helfen? "action" : "rerender" "triggerEvent" : "click", { { }); }, } "context" : "envParam:quiltName", } "context" : "envParam:quiltName", "useCountToKudo" : "false", { "action" : "rerender" } { { "actions" : [ "revokeMode" : "true", Somit bietet o2 hier die gleiche Flexibilität wie Vodafone. Schnell und einfach geht es über den Vodafone-Kundendienst. } ], }, The latest Tweets from bünyamin özcelik (@bba2323): "#StarTV" "actions" : [ ] "event" : "removeThreadUserEmailSubscription", } } }, LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_2061f642b8b504","nodesModel":{"2001|forum-board":{"title":"Board-Suche: Mobilfunk","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Mobilfunk","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: Mobilfunk","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_2061f642b8b504_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); { }, "context" : "envParam:quiltName,message", "useCountToKudo" : "false", } return; "action" : "rerender" B. bei einem Gerätewechsel – einfach erneut eingescannt werden . // Register the click event handler "event" : "unapproveMessage", "action" : "rerender" O2 oder Vodafone Freikarte – welche kostenlose Sim ist besser? LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, "actions" : [ ] } "actions" : [ { // console.log(key); "context" : "", // just for convenience, you need a login anyways... } }, { "context" : "envParam:quiltName,expandedQuiltName", }, "action" : "rerender" "context" : "", // Set start to true only if the first key in the sequence is pressed '; } "event" : "ProductMessageEdit", $(this).toggleClass("view-btn-open view-btn-close"); LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_2061f642b8b504_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/2001/thread-id/239367&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); $('#custom-overall-notif-count').html(notifCount); "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); ] ;(function($){ "}); "action" : "rerender" "context" : "", { var watching = false; Vodafone eSIM unter Windows 10 bestellen: Bestehendes eSIM-Profil unter Windows 10 aktivieren: Lies in dieser Schritt-für-Schritt Anleitung, wie Du Deine eSIM mit Deinem iPhone aktivierst. "context" : "", { "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", { }); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", Du bist otelo-Kunde? $(document).ready(function(){ "truncateBodyRetainsHtml" : "false", "actions" : [ { "event" : "unapproveMessage", ] } { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "actions" : [ "context" : "envParam:quiltName,message", "action" : "rerender" })(LITHIUM.jQuery); if ( key == neededkeys[0] ) { "actions" : [